DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and COL28A1

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:67 Identity:24/67 - (35%)
Similarity:38/67 - (56%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVVAVVPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLK 79
            |:::....|  .:.|:|.....||.|.::|..|.||...|.|..|::.||.|:.|||.:::||.:
Human  1058 PLLSTPVDG--AEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQE 1120

  Fly    80 TC 81
            ||
Human  1121 TC 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 19/49 (39%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 1/7 (14%)
Kunitz-type 1072..1122 CDD:444694 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.