DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG2816

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:80 Identity:29/80 - (36%)
Similarity:40/80 - (50%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTIFLLFLYPVVAVVP--QGFTIKQPK-CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGN 67
            |..:...|..::.::|  .|...|:.| |......|.|..:|:.:.|:.:...|..|.|||||||
  Fly     3 PAYWQWLLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGN 67

  Fly    68 PNRFYTKEECLKTCR 82
            .|||.||.||...||
  Fly    68 DNRFSTKAECEFNCR 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/49 (43%)
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 21/50 (42%)

Return to query results.
Submit another query.