DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG10031

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:70 Identity:24/70 - (34%)
Similarity:36/70 - (51%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVVA---VVPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEE 76
            |.||   :.||.. :..|||....:.|||...::.:.|:..:..|..|.||||.||.||:..::.
  Fly    57 PAVATTTIKPQRL-VPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQT 120

  Fly    77 CLKTC 81
            |.:.|
  Fly   121 CEEAC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 16/49 (33%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 16/49 (33%)

Return to query results.
Submit another query.