DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG15418

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster


Alignment Length:62 Identity:21/62 - (33%)
Similarity:26/62 - (41%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            :.|....:|||.     ||.|......:.|:..|..|..|.|.||....|.|.|.|||.:.|
  Fly    35 IEQIIACRQPKA-----PGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 16/49 (33%)
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 19/54 (35%)

Return to query results.
Submit another query.