DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Tfpi

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:80 Identity:30/80 - (37%)
Similarity:42/80 - (52%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRVYRPPNRKKREEN 95
            |...|..|||...::.:.::..:::|..|.||||.||.|||.|.|||.|||   .|..:|...:.
  Rat    53 CAMKAEDGPCKAMIRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKTC---IPGYKKTTIKT 114

  Fly    96 LDEEEEEEF---EED 107
            ....|:.:|   |||
  Rat   115 TSGAEKPDFCFLEED 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/49 (43%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656 23/53 (43%)
Kunitz_TFPI1_2-like 120..175 CDD:438657 4/10 (40%)
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.