DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Wfdc8

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001263361.1 Gene:Wfdc8 / 277343 MGIID:2685552 Length:426 Species:Mus musculus


Alignment Length:51 Identity:19/51 - (37%)
Similarity:26/51 - (50%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |...::.|.|.|.:..|.:|...::|..|.|.||.||.|.|.||.:|...|
Mouse   127 CMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNAC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 18/49 (37%)
Wfdc8NP_001263361.1 WAP 79..122 CDD:459672
Kunitz-type 127..177 CDD:438633 18/49 (37%)
WAP <180..222 CDD:238120
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.