| Sequence 1: | NP_723444.2 | Gene: | CG31609 / 318845 | FlyBaseID: | FBgn0051609 | Length: | 123 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263361.1 | Gene: | Wfdc8 / 277343 | MGIID: | 2685552 | Length: | 426 | Species: | Mus musculus |
| Alignment Length: | 51 | Identity: | 19/51 - (37%) |
|---|---|---|---|
| Similarity: | 26/51 - (50%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31609 | NP_723444.2 | Kunitz-type | 31..81 | CDD:444694 | 18/49 (37%) |
| Wfdc8 | NP_001263361.1 | WAP | 79..122 | CDD:459672 | |
| Kunitz-type | 127..177 | CDD:438633 | 18/49 (37%) | ||
| WAP | <180..222 | CDD:238120 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||