DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and AMBP

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:46 Identity:21/46 - (45%)
Similarity:33/46 - (71%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRV 83
            |||..|:::|.:|.:..:|:.|.||||.||.|:||:::||.:.|.|
Human   294 GPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 19/42 (45%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639
Kunitz_bikunin_2-like 284..338 CDD:438640 19/43 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.