DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:57 Identity:22/57 - (38%)
Similarity:32/57 - (56%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCR 82
            ::|..|....:||||..::..|.|:..|:.|..|.||||.||||.|.::..|...|:
Mouse   129 LRQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 20/49 (41%)
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672
Kunitz_eppin 132..188 CDD:438654 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.