DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Spint2

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_035594.1 Gene:Spint2 / 20733 MGIID:1338031 Length:252 Species:Mus musculus


Alignment Length:51 Identity:22/51 - (43%)
Similarity:27/51 - (52%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |...|..|||......|.||...|.||.|.||||.||.|.:.::|.|::.|
Mouse   133 CVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/49 (43%)
Spint2NP_035594.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 131..183 CDD:438665 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.