DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Papln

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln / 170721 MGIID:2386139 Length:1302 Species:Mus musculus


Alignment Length:78 Identity:26/78 - (33%)
Similarity:36/78 - (46%) Gaps:13/78 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLYPVVAVVPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEE 76
            :.|||..::|..             .|.|.|:...|.:.....||..|:||||.||.|.|.:::|
Mouse   766 YAYPVRCLLPSA-------------QGSCGDWAARWYFVASVGRCNRFWYGGCHGNANNFASEQE 817

  Fly    77 CLKTCRVYRPPNR 89
            |:.|||....|.|
Mouse   818 CMNTCRGQHGPRR 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAMTS_CR_3 86..183 CDD:437068
ADAMTS_spacer1 185..299 CDD:461796
TSP1_ADAMTS 309..361 CDD:465950
TSP1_ADAMTS 389..447 CDD:465950
TSP1_ADAMTS 450..503 CDD:465950
TSP1_ADAMTS 511..561 CDD:465950
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..737
Kunitz_papilin 772..822 CDD:438678 18/62 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..924 4/9 (44%)
Papilin_u7 831..922 CDD:374683 26/78 (33%)
Ig 932..>995 CDD:472250
Ig strand B 944..948 CDD:409389
Ig strand C 957..961 CDD:409389
Ig strand E 978..982 CDD:409389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1064
I-set 1070..1141 CDD:400151
Ig strand B 1083..1087 CDD:409353
Ig strand C 1096..1100 CDD:409353
Ig strand E 1117..1121 CDD:409353
Ig strand F 1131..1136 CDD:409353
Ig strand G 1144..1147 CDD:409353
Ig 1157..1241 CDD:472250
Ig strand B 1172..1176 CDD:409353
Ig strand C 1184..1188 CDD:409353
Ig strand E 1207..1211 CDD:409353
Ig strand F 1221..1226 CDD:409353
Ig strand G 1234..1237 CDD:409353
PLAC 1257..1289 CDD:462560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.