DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and Ambp

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:46 Identity:23/46 - (50%)
Similarity:33/46 - (71%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRV 83
            |||..|:|:|.:|....:||.|:||||.||.|:||:::||.:.|.|
Mouse   293 GPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYCGV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/42 (50%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639
Kunitz_bikunin_2-like 284..337 CDD:438640 21/43 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.