DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and Mansc1

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001103073.1 Gene:Mansc1 / 690606 RGDID:1593458 Length:419 Species:Rattus norvegicus


Alignment Length:244 Identity:49/244 - (20%)
Similarity:76/244 - (31%) Gaps:88/244 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YIEEDATKSVDEEPPADQFYRVEQHEPIPQAQVQQLPSRDKPKPFEYSSEDDYYDEHAEAKTTTT 236
            ||:.|   ....:||:   |..:.|     :|..||||             :....|...||   
  Rat   184 YIQVD---DASTQPPS---YEGKNH-----SQSLQLPS-------------ELNMVHLLPKT--- 221

  Fly   237 STSTTQAPLPILRARFGGFPWATTQAPS--PPTTSSTSSTTTTSTTTTTTTTSTTTTPSPRKQPK 299
                  .|.|.:..|  |...:.|..|:  ..:.|.|..|:.....||....:|.|:.||.    
  Rat   222 ------PPFPTVAPR--GSNVSATLKPALLLASISVTPKTSRPKDATTVPHVTTVTSESPA---- 274

  Fly   300 HIQVTGGLKPELLPADQLRNYIKDVYIRMPLAVIVDPSSASLEQAKRLYIDALQDKNIDIKIVLV 364
             :.|:.|..|                       :|.|.:|         :..:...:.|.|.:..
  Rat   275 -VPVSTGFIP-----------------------VVSPQAA---------LTTILQAHTDSKGIFK 306

  Fly   365 TLNAAGA------------PSAFSFNNTREFIAGLNSTKEHEGGNSFVG 401
            |:...|.            |:|.|.:.:...:  :|.|...|.|...||
  Rat   307 TVPFRGGSKLTSDTRHGKRPAATSLSTSESSV--INKTAPWENGRISVG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
Mansc1NP_001103073.1 MANEC 23..116 CDD:129004
AmyAc_family <164..236 CDD:298606 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16021
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.