DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and Mansc4

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001030075.1 Gene:Mansc4 / 545893 MGIID:3645619 Length:337 Species:Mus musculus


Alignment Length:355 Identity:72/355 - (20%)
Similarity:112/355 - (31%) Gaps:127/355 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 YY--KTGQTKAKSAKLQFPDKEKDTEKLEEDVDSPKNEIETFSEQEIQSS--------PNLNQTL 665
            ||  .|||...:|..|:            :||..   .:..|....:..:        |.|...:
Mouse    54 YYSENTGQKCGRSCCLR------------KDVSC---NVAVFFHDPVHDNVNCLHVHCPTLESCI 103

  Fly   666 LAPSTGQSRSTLNAMLLQRCGTKIELGIESKLLVMAGQTATLLFEVTNMKTETVYSTIQVTDERR 730
            |.|  |.|....|          |..||:..|||         ||.|:.......|:.:..|..|
Mouse   104 LEP--GASAILYN----------ITAGIDPDLLV---------FEHTSPIYPNSRSSSEWWDRLR 147

  Fly   731 FLVQLNPTRLSLRAQETATVRLTVLVPTGTAQGTTDR----ITFTNYGRETST------LAVNLK 785
            .|     ..:|:.::......:..:||:..|..||.:    .|..:|.|:::|      .:.|:.
Mouse   148 IL-----KAMSVGSEGVYPDVMNRMVPSTEAASTTQQDLGANTGISYSRKSTTDVGLRFTSANVS 207

  Fly   786 VVTSID-AQDSTGPTLSWEFGSRCDYLTPESQNCGERFWTVDVTAQDWQSGMMRLQASPP----- 844
            ..|.:: ...||..|.|           |.::.....|...|.......| ..||..|.|     
Mouse   208 TATKVNMVSPSTDFTHS-----------PGNKTISPFFGPTDTRVSQVPS-RSRLNISKPSVNKT 260

  Fly   845 EGLFYRNYYTAGSTE--------PLKATYMASCCEPKVSLIAFDAAGNQRSLTIDVRDVYLNEAA 901
            :|...||:    |:|        |..|....:|    |:|                      .||
Mouse   261 KGSHSRNH----SSENEEPWDGAPASAGVWLAC----VTL----------------------GAA 295

  Fly   902 IAAICLGVILLILLIAALIWSIVWCCRRRK 931
            :.::|..|:|          ....||.:|:
Mouse   296 VISLCCRVVL----------GTSRCCGKRQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
Mansc4NP_001030075.1 MANEC 24..113 CDD:129004 16/75 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 17/76 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..337 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.