DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and C11orf24

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_071733.1 Gene:C11orf24 / 53838 HGNCID:1174 Length:449 Species:Homo sapiens


Alignment Length:313 Identity:62/313 - (19%)
Similarity:110/313 - (35%) Gaps:65/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWLGVLLAALLLNTVVSGEDEDYGGEMIGSSLGGNDEIYDPAQLEAEVEKEMEQHRNSLEEDQTE 71
            :|.|::.....:.||.:...||.  .|..:|         |..|   .:.....|.||:|....:
Human    33 MWKGLVKRNASVETVDNKTSEDV--TMAAAS---------PVTL---TKGTSAAHLNSMEVTTED 83

  Fly    72 SSQVMELEVSTMRPMESRMNTMAPYS-GENSSAEMIDDASTQKRVSKVDKPARDYYYEDAPEDEM 135
            :|:....|.:|.......:.::||.: ..:::|..|..|::...|:           ..||....
Human    84 TSRTDVSEPATSGGAADGVTSIAPTAVASSTTAASITTAASSMTVA-----------SSAPTTAA 137

  Fly   136 VASTTAKVATTMIPEYVRQAKAERFPQRDQEHTSTDYIEEDATKSVDEEPPADQFYRVEQHEPIP 200
            .::|.|.:|.|.....:..|.:..........|||......:|.:......:....:|.:...:|
Human   138 SSTTVASIAPTTAASSMTAASSTPMTLALPAPTSTSTGRTPSTTATGHPSLSTALAQVPKSSALP 202

  Fly   201 Q-AQVQQLPSRDKPKPFEYSSEDDYYDEHAEAKTTTTSTS----------------TTQAPLPIL 248
            : |.:..|.:|                  |:...||.:||                |..:|:|.:
Human   203 RTATLATLATR------------------AQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPM 249

  Fly   249 RARFGGFPWATTQAPSPPTTSSTSSTTTTSTTT---TTTTTSTTTTPSPRKQP 298
            |.:..| |.:......|...::..||...|.||   ..|.|..|||.:..::|
Human   250 RPQAQG-PISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
C11orf24NP_071733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..101 7/28 (25%)
PHA03247 <133..391 CDD:223021 38/188 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..187 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..381 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.