DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and MANSC4

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001139693.1 Gene:MANSC4 / 100287284 HGNCID:40023 Length:340 Species:Homo sapiens


Alignment Length:369 Identity:74/369 - (20%)
Similarity:128/369 - (34%) Gaps:129/369 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 YY--KTGQTKAKSAKLQFPDKEKDTEKLEEDVDSPKNEIETFSEQEIQSS--------PNLNQTL 665
            ||  .|||..::|..|:            :||..   .:..|....|..:        |.|...:
Human    58 YYSESTGQKCSRSCCLR------------KDVSC---NLAVFYHSPIHDNINCLHVHCPTLESCI 107

  Fly   666 LAPSTGQSRSTLNAMLLQRCGTKIELGIESKLLVMAGQTATLLFEVTNMKTETVYSTIQVTDERR 730
            |.|.|       :|:|.     .|..||:..|||.. |:.|.|         ...|:....|..|
Human   108 LEPGT-------SAILY-----NITDGIDPDLLVFE-QSPTYL---------NTRSSSNRWDRLR 150

  Fly   731 FLVQLNPTRLSLRAQETATVRLTVLVPTGTAQGTT---DRITFTN---YGRETST------LAVN 783
            .|..:|        .:..|..:..::|:..|..:|   |.:..||   |.:|.:|      .::|
Human   151 ILKAMN--------LDKQTTTINGMLPSTEAPSSTTHQDLVVNTNSTSYSKELTTDFWARFTSLN 207

  Fly   784 LKVVTSIDAQDSTGPTLSWEFGSRCDYLT-PESQNCGERFWTVDVTAQDWQSGMMRLQASP-PEG 846
            ..:.|.|   :...|:        .|::: |:::.....|..:|.          :|...| |.|
Human   208 ESITTKI---NKVSPS--------TDFISNPDNKTISPFFEPIDT----------KLSHMPVPPG 251

  Fly   847 LFYRNYYTAGSTEPLKATYMASCCEPKVSLIAFDAAGNQRSLTIDVRDVYLNEAAIAAICLGVIL 911
            | ..:......|:...:....|..|.:||:       ..::..:.|           |:|..||.
Human   252 L-NSSKQLLNKTKGYNSRNHTSANEDEVSV-------TSKTWLVSV-----------ALCTSVIF 297

  Fly   912 L---ILLIAALIWSIVWCC----------RRRKTTLELPTYRSH 942
            |   |:::|:      .||          :|:..:|::.. |:|
Human   298 LGCCIVILAS------GCCGKQQGQYKPGQRKSGSLQIKN-RNH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
MANSC4NP_001139693.1 MANEC 29..117 CDD:129004 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..340 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.