DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and mansc1

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_005168547.1 Gene:mansc1 / 100009658 ZFINID:ZDB-GENE-070209-77 Length:451 Species:Danio rerio


Alignment Length:319 Identity:83/319 - (26%)
Similarity:121/319 - (37%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QTESSQVMELEVSTMRPMESRMNTMA----PYSGENSSAEMIDDASTQKRVSKVDKPARDYYYED 129
            ||.::.......:|.....:.|.|.|    |.|..:||:....:.||:.:..             
Zfish   143 QTSTTTTHRTTSTTTTGTRAAMTTTAEPAEPASASSSSSSSSSEFSTEPQTE------------- 194

  Fly   130 APEDEMVASTT---AKVATTMIPEYVRQAKAERFPQRDQEHTSTDYIEEDATKSVDEEPPADQFY 191
              |..|:.:.|   |..:|...|.....::|.|.|.:...          |.|  ..:|.....:
Zfish   195 --EPLMLMTNTPPAASTSTVTTPTSTSSSRAPRPPPKPSR----------ARK--PSKPSRPDTH 245

  Fly   192 RVEQHEPIPQAQVQQLPSRDKPKPFEYSSEDDYYDEHAEAKTTTTSTSTTQAPLPILRARFGGFP 256
            ......|.|.|.    |:...|.|..::.... ...|..|.||.|.|:||....|...       
Zfish   246 PARTSRPTPAAP----PTTHTPPPTTHTPPTT-STTHTPATTTHTPTTTTTTHTPPTT------- 298

  Fly   257 WATTQAP---------SPPTTSS--TSSTTT-TSTTTTTTTTSTT-TTPSPRKQPKHIQVTGGLK 308
             :||..|         :|||||:  ||:||| ||||||||||:|| |:||....|......|...
Zfish   299 -STTHTPPHTAPPTKKTPPTTSTTHTSATTTHTSTTTTTTTTTTTHTSPSTTHTPPATTPPGSSS 362

  Fly   309 PEL-LPADQLRNYIKDVYIRMPLAVIVDPSSASLEQAKRLYIDALQDKNIDIKIVLVTL 366
            |:. .|:..||..:..|     .|..:...|.:|....:..:..:..||..:.:|:|||
Zfish   363 PDAPSPSSVLRVDVGGV-----RAGSLPAGSVALRPPVQPAVSRVMWKNSLVAVVVVTL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
mansc1XP_005168547.1 MANEC 23..115 CDD:297649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.