DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and zgc:152904

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001070212.1 Gene:zgc:152904 / 767777 ZFINID:ZDB-GENE-060929-856 Length:809 Species:Danio rerio


Alignment Length:184 Identity:42/184 - (22%)
Similarity:79/184 - (42%) Gaps:27/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 QMKFYDIRSP--------LVLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIID 468
            ::.|.::::|        ..:.|:| ..:|...:.|......:|..|:  .||:::...|..|: 
Zfish    83 KLTFREVKTPQEFRQGDDAEVVCDV-ISSPVPAVSWFYKNREITSEPN--SRFQVLPTNNLQIL- 143

  Fly   469 KTDTNDDGKYSC--------EFDGVSKEIEVIARVVVRVPS---NTAVVEGEKMSVTCSVVGT-K 521
            |....|:|.|.|        |.|.....::|....|:.||.   |......|.::.||...|: .
Zfish   144 KVGKADEGAYRCEARVEARGEIDFRDIVVQVNVPPVLSVPQQSFNATADYQESVTFTCVTSGSPD 208

  Fly   522 PELTWTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA 575
            |::||.:....:.: :::::|...:.|  .:.||:.|:...|.|.|.|...|.|
Zfish   209 PQVTWYWKGHAIEH-SEQYVLNTMNGG--KSTLTVKNIKQTDGGPYMCRASNKA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 19/92 (21%)
Ig 423..497 CDD:299845 18/81 (22%)
IG_like 500..583 CDD:214653 20/80 (25%)
Ig 512..575 CDD:143165 16/63 (25%)
zgc:152904NP_001070212.1 Ig 1..81 CDD:299845
IG_like 2..80 CDD:214653
IGc2 97..158 CDD:197706 15/64 (23%)
Ig 177..273 CDD:299845 22/86 (26%)
I-set 184..270 CDD:254352 19/79 (24%)
Ig 272..369 CDD:299845
I-set 274..367 CDD:254352
IG_like 385..462 CDD:214653
IGc2 386..454 CDD:197706
FN3 468..561 CDD:238020
fn3 <591..650 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.