DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and nptn

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_012822135.1 Gene:nptn / 733721 XenbaseID:XB-GENE-1011670 Length:407 Species:Xenopus tropicalis


Alignment Length:243 Identity:75/243 - (30%)
Similarity:110/243 - (45%) Gaps:32/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 SPLVLSCNVKDGTPGGVL---IWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCE 481
            :|:.|.||:...:..|.|   .|.|||..|.|.......|.:     :..|.|...:|.|:|.|.
 Frog   168 TPIFLQCNLTVTSSQGELESVYWTKNGLEVQDTRKNSPEFVM-----ELKIAKPKADDSGEYMCV 227

  Fly   482 FDGVSKEIEVIARVVVR-VP------SNTAVVEGEKMSVTCSVVGTKPELTWTFANVT------L 533
            |...:......|.:.|: ||      .:....||::..:.|..||..|. .||:..:|      :
 Frog   228 FTFKNNSPPANATIEVKAVPEISGHKKSENKNEGQEAILYCKCVGYPPP-DWTWYKITDGGLTEV 291

  Fly   534 TNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKF 598
            .||:.|..:...||.....|:.||  ..:|.|.|.|   ||:|..|.:.||     |.:||:...
 Frog   292 NNASGRIFITNKDNNTELRIINLD--INNDPGTYLC---NASNTVGSDNTT-----TILRVRSNL 346

  Fly   599 AALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKKKRRN 646
            |.|||||||.||::||.::|::||||:...|:.:.|......|....|
 Frog   347 APLWPFLGIVAEIVILAVVIVVYEKRKRPDEVPDDDEPAGPMKSNSTN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 21/79 (27%)
Ig 423..497 CDD:299845 20/76 (26%)
IG_like 500..583 CDD:214653 26/94 (28%)
Ig 512..575 CDD:143165 20/68 (29%)
nptnXP_012822135.1 Ig 51..124 CDD:319273
Ig <190..238 CDD:386229 14/52 (27%)
Ig 259..342 CDD:386229 28/93 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10710
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto105034
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5184
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.