DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and BSG

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001719.2 Gene:BSG / 682 HGNCID:1116 Length:385 Species:Homo sapiens


Alignment Length:390 Identity:98/390 - (25%)
Similarity:154/390 - (39%) Gaps:106/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GASGEQTTISAATSTRAMMGG---------GGGVAGAGFSAGASGPMLGAGGHMLMGGQGHQVHL 389
            ||||....:.|..|.:..:||         |..|....:.....||. .....:..|.:..:||:
Human    18 GASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPN-DTCSQLWDGARLDRVHI 81

  Fly   390 Q---HQ-TLLPVKMDKLV-----------PNYDNAEH-----QMKFY------------------ 416
            .   || ....:.:|.||           .|..:..|     ::|:.                  
Human    82 HATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTV 146

  Fly   417 -DIRSPLVLSCNVKD-GTPGGVLIWKKNGTAVTD--VPSLRGRFKLIADENKFIIDKTDTNDD-G 476
             |:.|.::|:|::.| .|......|.|.|..:.:  :|..:..||:            |::|. |
Human   147 EDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKV------------DSDDQWG 199

  Fly   477 KYSCEFDGVSKEIEVIARV-------VVRVPSNTAVVEGEKMSVTCSVVGTKPELTWTFANVT-- 532
            :|||.|   ..|....|.:       |..|.|:..:.|||...:.|......|...|.:..:|  
Human   200 EYSCVF---LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDS 261

  Fly   533 ----LTNATD-RFILKPDDNGVPNAILTLDNVTLD-DRGEYKCIGRNAANVYGGNTTTPASD--V 589
                |.|.:: ||.:.....   .:.|.::|:.:: |.|:|:|.|          |::..||  :
Human   262 EDKALMNGSESRFFVSSSQG---RSELHIENLNMEADPGQYRCNG----------TSSKGSDQAI 313

  Fly   590 TTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESD--------TDPQEQKKKRRN 646
            .|:||:...|||||||||.||||:|..||.||||||...::.:.|        :..|.|..|.:|
Human   314 ITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKN 378

  Fly   647  646
            Human   379  378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 20/87 (23%)
Ig 423..497 CDD:299845 19/84 (23%)
IG_like 500..583 CDD:214653 19/90 (21%)
Ig 512..575 CDD:143165 15/70 (21%)
BSGNP_001719.2 IG_like 29..113 CDD:214653 15/84 (18%)
Ig 40..114 CDD:143165 13/74 (18%)
Essential for interaction with KDR/VEGFR2. /evidence=ECO:0000269|PubMed:25825981 195..199 1/3 (33%)
Ig 219..317 CDD:299845 25/110 (23%)
IG_like 228..318 CDD:214653 23/102 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..385 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157444
Domainoid 1 1.000 60 1.000 Domainoid score I10589
eggNOG 1 0.900 - - E1_28H7W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto91258
orthoMCL 1 0.900 - - OOG6_107774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.600

Return to query results.
Submit another query.