Sequence 1: | NP_723346.2 | Gene: | Bsg / 318841 | FlyBaseID: | FBgn0261822 | Length: | 648 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006243234.1 | Gene: | Nptn / 56064 | RGDID: | 620296 | Length: | 397 | Species: | Rattus norvegicus |
Alignment Length: | 247 | Identity: | 77/247 - (31%) |
---|---|---|---|
Similarity: | 110/247 - (44%) | Gaps: | 47/247 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 PLVLSCNVKDGTPGGVLI---WKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEF 482
Fly 483 DGVS-----KEIEVIARVVVRVPSNTA------VVEGEKMSVTCSVVG-TKPELTW------TFA 529
Fly 530 NVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRV 594
Fly 595 KGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKKKRRN 646 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bsg | NP_723346.2 | IG_like | 420..497 | CDD:214653 | 23/83 (28%) |
Ig | 423..497 | CDD:299845 | 22/81 (27%) | ||
IG_like | 500..583 | CDD:214653 | 27/95 (28%) | ||
Ig | 512..575 | CDD:143165 | 20/69 (29%) | ||
Nptn | XP_006243234.1 | Ig | 31..146 | CDD:416386 | |
Ig strand A | 32..36 | CDD:409353 | |||
Ig strand A' | 37..43 | CDD:409353 | |||
Ig strand B | 46..55 | CDD:409353 | |||
Ig strand C | 60..68 | CDD:409353 | |||
Ig strand C' | 73..77 | CDD:409353 | |||
Ig strand D | 87..93 | CDD:409353 | |||
Ig strand E | 96..105 | CDD:409353 | |||
Ig strand F | 112..120 | CDD:409353 | |||
Ig strand G | 136..146 | CDD:409353 | |||
Ig | 167..218 | CDD:416386 | 15/59 (25%) | ||
Ig strand C | 179..184 | CDD:409353 | 0/4 (0%) | ||
Ig strand E | 200..204 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 214..218 | CDD:409353 | 1/3 (33%) | ||
Ig | 249..332 | CDD:416386 | 28/94 (30%) | ||
Ig strand B | 252..261 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 266..272 | CDD:409353 | 3/5 (60%) | ||
Ig strand C' | 275..277 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 288..293 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 296..304 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 312..319 | CDD:409353 | 5/9 (56%) | ||
Ig strand G | 322..332 | CDD:409353 | 4/14 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166351413 | |
Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10630 |
eggNOG | 1 | 0.900 | - | - | E1_28H7W | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X1696 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
7 | 6.700 |