DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and cd22

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001077292.1 Gene:cd22 / 554810 ZFINID:ZDB-GENE-050522-521 Length:417 Species:Danio rerio


Alignment Length:318 Identity:69/318 - (21%)
Similarity:113/318 - (35%) Gaps:92/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 GAGGHMLMGGQGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDGTP-GGV 436
            |:||..|           ...:||:   :::.....|..|:   |....:.|:|:.::.|| ...
Zfish   128 GSGGIQL-----------KVAVLPL---RVIVKTQKASEQI---DEGDSVTLTCSAENCTPTEES 175

  Fly   437 LIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEFDGVSKEIEVIARVVVR--- 498
            .:|.||...   :|...|        |:..|.....:|.|.|||.....:..:.....:.||   
Zfish   176 FLWFKNHLL---LPQATG--------NELRISSVSHSDAGNYSCGLKNTNTTLSAQTLLDVRYQP 229

  Fly   499 ------VPSNTAVVEGEKMSVTCSVVGTKPELT---W---TFANVTLTNATDRFILKPDDNGVPN 551
                  |.|:..:.||..:::||. ....|.:|   |   |.||::...:              .
Zfish   230 KDVEISVSSSEEIQEGNPLTLTCK-SKANPAVTHYSWFKITDANMSSVGS--------------G 279

  Fly   552 AILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGK----FAALWPFLGICAEVL 612
            :.||:.:.:|.|.|.|.|   .|.|..|    |..|.|..::|...    .:|...||.:.|.:|
Zfish   280 SELTIRSASLQDAGLYFC---TATNHIG----TQKSTVKALKVASDRHFLLSASAVFLFVMAMLL 337

  Fly   613 ILCIII---------------------LIYEK-RRNKSELEESDTDPQEQKKKRRNYD 648
            :|.::.                     :|||. |:.:||...|.....:.|....|.|
Zfish   338 VLFVLFVRKKLFTSQKQTAEQMPAVTEVIYENLRKTESETNTSTVIYADLKLPPSNSD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 16/77 (21%)
Ig 423..497 CDD:299845 16/74 (22%)
IG_like 500..583 CDD:214653 21/88 (24%)
Ig 512..575 CDD:143165 15/68 (22%)
cd22NP_001077292.1 Ig 19..122 CDD:299845
IG_like 25..136 CDD:214653 4/18 (22%)
IG_like 156..225 CDD:214653 16/79 (20%)
IGc2 156..208 CDD:197706 14/62 (23%)
IG_like 237..315 CDD:214653 24/99 (24%)
IGc2 244..304 CDD:197706 19/77 (25%)
MSC <307..386 CDD:286487 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.