DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and bsg

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_012818113.1 Gene:bsg / 549438 XenbaseID:XB-GENE-5901795 Length:386 Species:Xenopus tropicalis


Alignment Length:275 Identity:71/275 - (25%)
Similarity:114/275 - (41%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 HQTLLP-VKMDKLVPNYDNAEH----QMKFYDIRSPLVLSCNVKDGTPGGVLIWKKNGTAVTDVP 450
            |.|.:| :|..:...|....:|    ....|...:.::|:||:...:......|.|.|..:.:  
 Frog   120 HLTKIPRIKWIRSQANVMVIDHPDIMTNAVYMTENTMILTCNLSANSFVSGHRWLKGGKVLKE-- 182

  Fly   451 SLRGRFKLIADENKFIIDKTDTN------------DDGKYSCEF---DGVSKEIEV-IARVVVRV 499
                             ||..:|            ..|:|.|||   ..|||.:.| ::..|...
 Frog   183 -----------------DKDTSNIMTYNVSGLPEEGSGQYICEFLTTPNVSKVVNVSVSPQVHHY 230

  Fly   500 PSNTAVVEGEKMSVTCSVVGTKPELTWTFANVTL-------TNATDRFILKPDDNGVPNAILTLD 557
            .:.....||:...:||......|...|::..|:.       ..::||:::|...|   ..:|.:.
 Frog   231 KATEHGNEGDTGVLTCKSSSFPPVTDWSWYIVSPNGVEAIGNGSSDRYVIKSSGN---QTVLRIH 292

  Fly   558 NVTLD-DRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIY 621
            |:.:: |:.:|.|.|.|.....|        ||..:.|:.:.|||||||||..||::|..||.||
 Frog   293 NLDIENDQHDYTCNGTNELGAKG--------DVVHLHVRSRLAALWPFLGIVGEVVVLVTIIFIY 349

  Fly   622 EKRRNKSEL-EESDT 635
            ||||...|: |:.|:
 Frog   350 EKRRKPDEVCEDEDS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 18/92 (20%)
Ig 423..497 CDD:299845 18/89 (20%)
IG_like 500..583 CDD:214653 19/90 (21%)
Ig 512..575 CDD:143165 16/70 (23%)
bsgXP_012818113.1 Ig_3 27..114 CDD:372822
IG_like 233..322 CDD:214653 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10710
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.