DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and ROBO4

DIOPT Version :10

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_061928.4 Gene:ROBO4 / 54538 HGNCID:17985 Length:1007 Species:Homo sapiens


Alignment Length:303 Identity:61/303 - (20%)
Similarity:104/303 - (34%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SRTASTPASVSDEDRLSPEIAQKAPKIVGSCNSDDLRPVQCHLETKELWDK-FNELGTEMIITKT 162
            ||.|::.|..|    |:||..:|....:..|..|.|:       ||:.::| ..||      .:|
Human   171 SREANSKADPS----LNPEQLKKLQDKIEKCKQDVLK-------TKDKYEKSLKEL------DQT 218

  Fly   163 GRRMFPTVRVSFSGPMRHQTAADRY--AVLLDI---IPLDN-RRYRYAYH------RSA------ 209
            ..:....:...|....:.:....|:  .|||::   :.|.| ..|:..|.      ::|      
Human   219 TPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDL 283

  Fly   210 -WLVAGKADPPPPARLYSHPDTPLGPDALRRQVISFEK------IKLT--NNEMDKTGQIVLNSM 265
             |..|...    |....:.|........|.|.:...||      :.||  |...|::||....|:
Human   284 RWFRANHG----PGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQSGQNKPGSV 344

  Fly   266 HRYQPRIHLVRIGPNQSVPT---------------SPAELQELDHKTFVFPETIFTAVTAYQNQ- 314
            ..|:         ..|:.||               :..:....|..|....|....|:..|:.| 
Human   345 SSYE---------KTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTEVRVRALYDYEGQE 400

  Fly   315 ----------LITKLK-IDSNPFAKGFRDSSRLNDFDRDPMES 346
                      .:||:: .|...:.||..||.::..:..:.:|:
Human   401 HDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 Ig 423..481 CDD:472250
Ig strand B 423..426 CDD:409353
Ig strand C 436..440 CDD:409353
Ig strand E 463..467 CDD:409353
Ig strand F 477..481 CDD:409353
Ig_3 495..573 CDD:464046
ROBO4NP_061928.4 Ig 32..133 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand F 111..116 CDD:409353
Ig strand G 125..128 CDD:409353
IgI_2_Robo 140..225 CDD:409389 18/70 (26%)
Ig strand A 140..143 CDD:409389
Ig strand A' 145..149 CDD:409389
Ig strand B 153..160 CDD:409389
Ig strand C 168..173 CDD:409389 1/1 (100%)
Ig strand C' 175..178 CDD:409389 0/2 (0%)
Ig strand D 183..187 CDD:409389 2/3 (67%)
Ig strand E 190..196 CDD:409389 0/5 (0%)
Ig strand F 203..211 CDD:409389 2/14 (14%)
Ig strand G 214..225 CDD:409389 3/16 (19%)
fn3 350..432 CDD:394996 16/81 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..551
PHA03247 <567..876 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 971..1007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.