DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and nptnb

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_991268.1 Gene:nptnb / 403006 ZFINID:ZDB-GENE-040426-1821 Length:403 Species:Danio rerio


Alignment Length:279 Identity:81/279 - (29%)
Similarity:127/279 - (45%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 QGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDG-TPGGVLIWKKNGTAV 446
            |..:::...|.:|..|..|  .:.|..|          |:||.||:.:. :......|.|||   
Zfish   143 QRPRINASDQEILQPKSSK--TSQDPPE----------PIVLKCNLTNSHSTHQETFWMKNG--- 192

  Fly   447 TDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEFD-------GVSKEIEVIARVVVRVPSNTA 504
            .::.|.|.:.|    ..:|.::|..|:|.|:|.|.:.       ..|.|::....::....|...
Zfish   193 QEISSSRTQRK----HTEFRLNKPRTDDSGEYMCVYTFKSAPNANASIEVKACPEIIGHKRSENK 253

  Fly   505 VVEGEKMSVTCSVVGTKPELTWTF-------ANVTLTNATDRFILKPDDNGVPNAILTLDNVTLD 562
             .|||..::.|...| .|...||:       :.:.:.|:|.||.:...:|....:||.||..|  
Zfish   254 -KEGENATLYCKSAG-YPHPVWTWRKKVGRDSYMDIDNSTGRFFIVNRENFTELSILDLDIRT-- 314

  Fly   563 DRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNK 627
            |.|||.|   ||:|:.|...::     |.:||:...|.||||||:.||::||.:||::||||:..
Zfish   315 DPGEYFC---NASNIIGFTNSS-----TILRVRSHLAPLWPFLGVLAEIIILVVIIVVYEKRKKP 371

  Fly   628 SELEESDTDPQEQKKKRRN 646
            .|:.|.|......|....|
Zfish   372 DEVFEDDEPVTTMKTNSTN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 21/84 (25%)
Ig 423..497 CDD:299845 20/81 (25%)
IG_like 500..583 CDD:214653 28/89 (31%)
Ig 512..575 CDD:143165 21/69 (30%)
nptnbNP_991268.1 IGc2 42..117 CDD:197706
IG_like 168..223 CDD:214653 19/71 (27%)
Ig 170..223 CDD:299845 17/59 (29%)
Ig 242..338 CDD:299845 29/107 (27%)
IG_like 249..338 CDD:214653 29/100 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593211
Domainoid 1 1.000 57 1.000 Domainoid score I10838
eggNOG 1 0.900 - - E1_28H7W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40657
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5184
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.