DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and vstm2l

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_956790.2 Gene:vstm2l / 393468 ZFINID:ZDB-GENE-040426-1548 Length:187 Species:Danio rerio


Alignment Length:93 Identity:22/93 - (23%)
Similarity:38/93 - (40%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 VPSNTAVVEGEKMSVTCSVVGTKP-----ELTWTFAN-------------VTLTN----ATDRFI 541
            ||::.....||.:.::||..|:..     |:.|.::.             |:..|    ||...:
Zfish    39 VPADVFSRAGEDVEMSCSFRGSSSSSVSLEIQWWYSRQWAEPLPWATNQVVSQENASKGATKISV 103

  Fly   542 LKPDDNGVPNAILTLDNVTLDDRGEYKC 569
            :|...:.:.:. |.|.||...|.|.|:|
Zfish   104 VKVVGSNISHK-LRLSNVKPSDEGTYEC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653
Ig 423..497 CDD:299845
IG_like 500..583 CDD:214653 21/92 (23%)
Ig 512..575 CDD:143165 18/80 (23%)
vstm2lNP_956790.2 Ig <115..143 CDD:325142 8/16 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.