DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and TMIGD1

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:235 Identity:47/235 - (20%)
Similarity:89/235 - (37%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 LSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIA----DENKFIIDKTDTNDDG-KYSCEFD 483
            |.|.|::.|....|:|.:.          .||..|.:    :.:...:.....||:| .::|.. 
Human    52 LICAVQNHTREEELLWYRE----------EGRVDLKSGNKINSSSVCVSSISENDNGISFTCRL- 105

  Fly   484 GVSKEIEVIARVVVRVP------SNTAVVEGEKMSVTCSV-VGTKPELTWTFANVTLTNATDRFI 541
            |..:.:.|...:.|..|      ....|.||..:.:.|:| ...:.::.| :.|.:|.:      
Human   106 GRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMW-YKNSSLLD------ 163

  Fly   542 LKPDDNGVPNAI----LTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAA-- 600
            |:...:.:....    |::..|...|.|.|.||.:::..       |.:.|...: ||.|...  
Human   164 LEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLK-------TESLDFHLI-VKDKTVGVP 220

  Fly   601 LWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQ 640
            :.|.:..|. |:.|.:...:..:|:...:|...|.||..:
Human   221 IEPIIAACV-VIFLTLCFGLIARRKKIMKLCMKDKDPHSE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 15/77 (19%)
Ig 423..497 CDD:299845 15/77 (19%)
IG_like 500..583 CDD:214653 17/93 (18%)
Ig 512..575 CDD:143165 13/67 (19%)
TMIGD1NP_996663.1 IG 131..212 CDD:214652 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.