DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and nptna

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001153628.1 Gene:nptna / 368305 ZFINID:ZDB-GENE-030804-7 Length:277 Species:Danio rerio


Alignment Length:262 Identity:70/262 - (26%)
Similarity:112/262 - (42%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 PNYDNAEHQMKFYDIRSPLVLSCNV-KDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFII 467
            |:.|::||.:......|.:.|.||: ...:......|.|||..:.|.   |.:.|    ..::.:
Zfish    26 PSIDSSEHMILTMGSSSSITLQCNLTASQSSHRESFWMKNGEEIMDT---RDKTK----NTEYKL 83

  Fly   468 DKTDTNDDGKYSC--EFDGVSKEIEVIARVVVRVPSNTAVV---------EGEKMSVTCSVVGTK 521
            .|...:|.|:|.|  .||...:     |...:.:.:...:.         |||:..:.|..|| .
Zfish    84 TKPKADDAGEYMCVYTFDSAPQ-----ANATIEIKAGPEITTHKHSENKNEGERAILFCKSVG-Y 142

  Fly   522 PELTWTFANV-------TLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYG 579
            |...|::..:       .:.|::.||.:...|.....:|:.||  ...|.|||:|   ||.|.  
Zfish   143 PYPQWSWRKIDNGASMEMMDNSSGRFFIISKDGYTELSIINLD--INSDPGEYEC---NATNF-- 200

  Fly   580 GNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKKKR 644
               .:..|....:||:...|.|||.||:.||::||.:||:|||||:...|:.:.|......|...
Zfish   201 ---ISSTSKKWILRVRSHLAPLWPLLGVLAEIIILVLIIVIYEKRKKPDEVPDDDEPAGPMKTNS 262

  Fly   645 RN 646
            .|
Zfish   263 TN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 19/79 (24%)
Ig 423..497 CDD:299845 18/76 (24%)
IG_like 500..583 CDD:214653 23/98 (23%)
Ig 512..575 CDD:143165 18/69 (26%)
nptnaNP_001153628.1 IG_like 42..113 CDD:214653 19/82 (23%)
Ig 46..97 CDD:299845 14/57 (25%)
Ig 116..212 CDD:299845 24/106 (23%)
IG_like 128..212 CDD:214653 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593212
Domainoid 1 1.000 57 1.000 Domainoid score I10838
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.