DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and CG44153

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001097136.2 Gene:CG44153 / 34341 FlyBaseID:FBgn0265002 Length:1946 Species:Drosophila melanogaster


Alignment Length:272 Identity:64/272 - (23%)
Similarity:100/272 - (36%) Gaps:84/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 SPLVLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRF-KLIADENKFI------IDKTDTNDDGK 477
            |..::||..: |:......|.|:|..|....|.|..: .::..|.|.:      :.|....|:|.
  Fly   471 SEFIISCTAQ-GSSRMQFQWFKDGAVVNASKSTREIWTTVLPPETKDVYTAILGVTKASRIDEGV 534

  Fly   478 YSCEFD--GV----SKEIEVIARVVVRV-PSNTAVVEGEKMSVTCSVVG-------TKPELTWTF 528
            |||:..  ||    |..|.:.:...:|| |::..:..|:.:.|.|...|       .:...:||.
  Fly   535 YSCKVTDWGVEQCRSLHIHIKSPPRLRVDPASVTLQRGDSLRVRCLSPGNDDIKRYAQLGYSWTR 599

  Fly   529 ANVTLTN--ATDRF-ILKPDDNGVPNAILTLDNVTLDDRGEYKC-----------------IGRN 573
            ..|...:  ||..: .|.||     .:||.::|:  ....||.|                 |.||
  Fly   600 NGVLFQSDAATAMWEDLYPD-----GSILKINNI--QKSAEYACLVSNSVRPVSRSVYINVIERN 657

  Fly   574 AANV------YGGN--TTTPASDVTT---------------VRVKGKFAALWP-FLGICAEVLIL 614
            |.:|      ||.:  |:.|.|.:.|               .|..|....|.| |.|        
  Fly   658 AVHVCPAESTYGVHWPTSAPGSPIITDCPRGFEGHLKRICEQRDTGNSTWLLPDFSG-------- 714

  Fly   615 CI---IILIYEK 623
            |:   ::|||.:
  Fly   715 CVRDELLLIYNR 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 22/89 (25%)
Ig 423..497 CDD:299845 21/86 (24%)
IG_like 500..583 CDD:214653 26/117 (22%)
Ig 512..575 CDD:143165 20/89 (22%)
CG44153NP_001097136.2 EGF_CA <264..294 CDD:238011
IG_like 467..554 CDD:214653 22/83 (27%)
Ig 474..551 CDD:143165 20/77 (26%)
IG_like 564..653 CDD:214653 19/95 (20%)
Ig 572..642 CDD:299845 18/76 (24%)
HRM 661..718 CDD:280888 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.