DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and Fas2

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:206 Identity:53/206 - (25%)
Similarity:86/206 - (41%) Gaps:31/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 VLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEFDGVSK 487
            |:.|.|| ..|...:.|.:||..:.....     |.:...|..:|.....:|:|.|:|. ..|.:
  Fly   156 VVMCEVK-ADPNPTIDWLRNGDPIRTTND-----KYVVQTNGLLIRNVQESDEGIYTCR-AAVIE 213

  Fly   488 EIEVIARV----------VVRVPSNTAVVEGEKMSVTCSVVGTK-PELTWTFANVTLTNAT-DRF 540
            ..|::.|.          ::.:|:|...|||:..:..|:..|.. ||::|......|..|| |||
  Fly   214 TGELLERTIRVEV
FIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRF 278

  Fly   541 ILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAALWPFL 605
            .:.|.     ..::|:.:|:.||.|.|.|:.:|.|.|....|.      ..|.|:.:...|:...
  Fly   279 QVNPQ-----TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTK------LNVLVRPQIYELYNVT 332

  Fly   606 GI-CAEVLILC 615
            |. ..|:.|.|
  Fly   333 GARTKEIAITC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 18/83 (22%)
Ig 423..497 CDD:299845 18/83 (22%)
IG_like 500..583 CDD:214653 27/84 (32%)
Ig 512..575 CDD:143165 20/64 (31%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 18/76 (24%)
IGc2 152..209 CDD:197706 15/59 (25%)
I-set 230..319 CDD:254352 28/99 (28%)
IGc2 243..309 CDD:197706 22/70 (31%)
IG_like 330..424 CDD:214653 4/14 (29%)
IGc2 339..412 CDD:197706 2/5 (40%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.