Sequence 1: | NP_723346.2 | Gene: | Bsg / 318841 | FlyBaseID: | FBgn0261822 | Length: | 648 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 31/206 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 423 VLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEFDGVSK 487
Fly 488 EIEVIARV----------VVRVPSNTAVVEGEKMSVTCSVVGTK-PELTWTFANVTLTNAT-DRF 540
Fly 541 ILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAALWPFL 605
Fly 606 GI-CAEVLILC 615 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bsg | NP_723346.2 | IG_like | 420..497 | CDD:214653 | 18/83 (22%) |
Ig | 423..497 | CDD:299845 | 18/83 (22%) | ||
IG_like | 500..583 | CDD:214653 | 27/84 (32%) | ||
Ig | 512..575 | CDD:143165 | 20/64 (31%) | ||
Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | |
IG_like | 144..226 | CDD:214653 | 18/76 (24%) | ||
IGc2 | 152..209 | CDD:197706 | 15/59 (25%) | ||
I-set | 230..319 | CDD:254352 | 28/99 (28%) | ||
IGc2 | 243..309 | CDD:197706 | 22/70 (31%) | ||
IG_like | 330..424 | CDD:214653 | 4/14 (29%) | ||
IGc2 | 339..412 | CDD:197706 | 2/5 (40%) | ||
Ig | 447..518 | CDD:143165 | |||
fn3 | 534..611 | CDD:278470 | |||
FN3 | 640..735 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10075 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |