DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and Bsg

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:243 Identity:76/243 - (31%)
Similarity:111/243 - (45%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 DIRSPLVLSCNVKDGTPGGVLI----WKKNGTAVTD--VPSLRGRFKLIADENKFIIDKTDTNDD 475
            ::.|...|:|.:..   .|:.|    |.:.|..:.:  :|.|:.::.:.||:.           .
  Rat   148 EVDSKTQLTCFLNS---SGIDIVGHRWMRGGKVLQEDTLPDLQMKYTVDADDR-----------S 198

  Fly   476 GKYSCEF--DGVSK---EIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKP---ELTW------ 526
            |:|||.|  :.|.:   .:|...|:.|...|..| .|||.:.:.|....:.|   |..|      
  Rat   199 GEYSCIFLPEPVGRGNINVEGPPRIKVGKKSEHA-SEGEFVKLICKSEASHPPVDEWVWFKTSDT 262

  Fly   527 ---TFANVTLTNATDRFILKPDDNGVPNAILTLD-NVTLDDRGEYKCIGRNAANVYGGNTTTPAS 587
               |.:|.|..|:....|..|:.:.:  .|..|| ||   |.|.|.|   ||.|..|.     |.
  Rat   263 GDQTISNGTEANSKYVIISTPELSEL--IISDLDMNV---DPGTYVC---NATNSQGS-----AR 314

  Fly   588 DVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE-LEESD 634
            :..::||:.:.|||||||||.||||:|..||.||||||...: |:|.|
  Rat   315 ETISLRVRSRLAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 19/87 (22%)
Ig 423..497 CDD:299845 18/84 (21%)
IG_like 500..583 CDD:214653 28/95 (29%)
Ig 512..575 CDD:143165 20/75 (27%)
BsgNP_001103352.1 IG_like 29..113 CDD:214653
Ig 40..111 CDD:143165
Ig 139..203 CDD:299845 11/60 (18%)
IG_like 228..321 CDD:214653 30/105 (29%)
Ig 238..318 CDD:143165 26/92 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351414
Domainoid 1 1.000 57 1.000 Domainoid score I10630
eggNOG 1 0.900 - - E1_28H7W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98344
orthoMCL 1 0.900 - - OOG6_107774
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.600

Return to query results.
Submit another query.