DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and Nptn

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_006510945.1 Gene:Nptn / 20320 MGIID:108077 Length:397 Species:Mus musculus


Alignment Length:247 Identity:76/247 - (30%)
Similarity:111/247 - (44%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 PLVLSCNVKDGTPGGVLI---WKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEF 482
            |:.|.||:...:  ..|:   |.:||..:|..       :..|...::.|:|....|.|:|.|.:
Mouse   164 PVTLQCNLTSSS--HTLMYSYWTRNGVELTAT-------RKNASNMEYRINKPRAEDSGEYHCVY 219

  Fly   483 DGVS-----KEIEVIARVVVRVPSNTA------VVEGEKMSVTCSVVG-TKPELTW------TFA 529
            ..||     ..|||.|     .|..|.      ..||:...:.|..|| ..||..|      .|.
Mouse   220 HFVSAPKANATIEVKA-----APDITGHKRSENKNEGQDAMMYCKSVGYPHPEWIWRKKENGVFE 279

  Fly   530 NVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRV 594
            .:  :|::.||.:...:|....:|:.| .:| :|.|||:|   ||.|..|.     ||..|.:||
Mouse   280 EI--SNSSGRFFITNKENYTELSIVNL-QIT-EDPGEYEC---NATNSIGS-----ASVSTVLRV 332

  Fly   595 KGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKKKRRN 646
            :...|.|||||||.||::||.:||::||||:...|:.:.|......|....|
Mouse   333 RSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 22/83 (27%)
Ig 423..497 CDD:299845 21/81 (26%)
IG_like 500..583 CDD:214653 27/95 (28%)
Ig 512..575 CDD:143165 20/69 (29%)
NptnXP_006510945.1 Ig 48..121 CDD:319273
Ig 167..218 CDD:386229 14/59 (24%)
Ig 249..332 CDD:386229 28/94 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847849
Domainoid 1 1.000 57 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_28H7W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5184
SonicParanoid 1 1.000 - - X1696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.730

Return to query results.
Submit another query.