DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and Emb

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_034460.3 Gene:Emb / 13723 MGIID:95321 Length:330 Species:Mus musculus


Alignment Length:306 Identity:67/306 - (21%)
Similarity:106/306 - (34%) Gaps:102/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 TLLPVKMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDGTPGGVLI------------------- 438
            |.|||: ::::..|.|..            :.|||:.......|.:                   
Mouse    41 TSLPVR-EEMMAKYSNLS------------LKSCNISVTEKSNVSVEENVILEKPSHVELKCVYT 92

  Fly   439 -----------WKKNGTAVTDVP-SLRGRF------KLIADENKFIIDKTDTNDDGKYSCEFDGV 485
                       |||:     |.| ...|.|      ..:..:.:||:  .::...|||||.|.  
Mouse    93 ATKDLNLMNVTWKKD-----DEPLETTGDFNTTKMGNTLTSQYRFIV--FNSKQLGKYSCVFG-- 148

  Fly   486 SKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPEL------------TWTFANVTL----- 533
              |.|:.....:.||.    ..|:|.|: .:.||....|            ||...|.|.     
Mouse   149 --EKELRGTFNIHVPK----AHGKKKSL-IAYVGDSTVLKCVCQDCLPLNWTWYMGNETAQVPID 206

  Fly   534 TNATDRFILKPDDNG--VPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKG 596
            .::.:::|:    ||  .....|.:.::..:|.|.|.|   .|....|     .:.:...:.|..
Mouse   207 AHSNEKYII----NGSHANETRLKIKHLLEEDGGSYWC---RATFQLG-----ESEEQNELVVLS 259

  Fly   597 KFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKK 642
            ....|.|||.|.|||::|..|||:.|...:|.:     .||...|:
Mouse   260 FLVPLKPFLAILAEVILLVAIILLCEVYTHKKK-----NDPDAGKE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 21/113 (19%)
Ig 423..497 CDD:299845 21/110 (19%)
IG_like 500..583 CDD:214653 21/101 (21%)
Ig 512..575 CDD:143165 16/81 (20%)
EmbNP_034460.3 Ig 85..146 CDD:143165 13/67 (19%)
IG_like 168..257 CDD:214653 18/101 (18%)
Ig 179..250 CDD:143165 15/82 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..330 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.