| Sequence 1: | NP_723346.2 | Gene: | Bsg / 318841 | FlyBaseID: | FBgn0261822 | Length: | 648 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_542174.1 | Gene: | VSTM2L / 128434 | HGNCID: | 16096 | Length: | 204 | Species: | Homo sapiens |
| Alignment Length: | 212 | Identity: | 43/212 - (20%) |
|---|---|---|---|
| Similarity: | 68/212 - (32%) | Gaps: | 81/212 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 ALSFLSIFLAIYAQSLA-------NDLSKESTEFEESPTIYYGDPVVNLGQPFSITCII------ 60
Fly 61 ---------------PITDQIHWLKN----------GEPITR------------HNLRHGR---- 84
Fly 85 DDHAY---VLSESAIEGEKHKIEAHLSVRHALKVHEGRYQCNRRRGSYILHVRDPKGVGAGAGEP 146
Fly 147 TESGYQTIDELTPNSAD 163 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bsg | NP_723346.2 | IG_like | 420..497 | CDD:214653 | |
| Ig | 423..497 | CDD:299845 | |||
| IG_like | 500..583 | CDD:214653 | |||
| Ig | 512..575 | CDD:143165 | |||
| VSTM2L | NP_542174.1 | Ig | 43..144 | CDD:416386 | 18/104 (17%) |
| FR1 | 44..63 | CDD:409353 | 4/22 (18%) | ||
| Ig strand A' | 50..52 | CDD:409353 | 0/1 (0%) | ||
| Ig strand B | 56..64 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 64..71 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 72..93 | CDD:409353 | 2/20 (10%) | ||
| Ig strand D | 113..118 | CDD:409353 | 0/4 (0%) | ||
| FR3 | 114..142 | CDD:409353 | 6/27 (22%) | ||
| Ig strand E | 122..130 | CDD:409353 | 3/7 (43%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 168..204 | 10/36 (28%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165157445 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||