DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and Emb

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_446171.1 Gene:Emb / 114511 RGDID:621067 Length:328 Species:Rattus norvegicus


Alignment Length:308 Identity:71/308 - (23%)
Similarity:112/308 - (36%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 TLLPVKMDKLVPNYDNAEHQMKFYDIR-----------------SPLVLSCNVKDGTPGGVLIWK 440
            |.|||: ::::..|.|.  .::.|:|.                 |.|.|.|..            
  Rat    41 TSLPVR-EEMMAKYANL--SLETYNISLTEQTRVSEQNITLERPSHLELECTF------------ 90

  Fly   441 KNGTAVTDVPSLRGRFKLIADENKFIIDKTD---------------------TNDDGKYSCEFDG 484
               ||..||.|:...:|    ::..:::.||                     :...||||| |.|
  Rat    91 ---TATEDVMSMNVTWK----KDDALLETTDGFNTTKMGDTLYSQYRFTVFNSKQMGKYSC-FLG 147

  Fly   485 VSKEIEVIARVVVRVP----SNTAVVE--GEKMSVTCSVVGTKP-ELTWTFANVTL-----TNAT 537
            .    |:.....:|||    .|..::.  |:...:.|......| ..||..:|.|.     .:..
  Rat   148 E----ELRGTFNIRVPKVHGKNKPLITYVGDSTVLKCECQNCLPLNWTWYMSNGTAQVPIDVHVN 208

  Fly   538 DRFILKPDDNG--VPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAA 600
            |:|    |.||  .....|.:.::..:|.|.|.|   .||...|     .:.:...:.|......
  Rat   209 DKF----DINGSYANETKLKVKHLLEEDGGSYWC---RAAFPLG-----ESEEHIKLVVLSFMVP 261

  Fly   601 LWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEQKKKRRNYD 648
            |.|||.|.|||::|..|||:.|....|.:.:..|....||.::.::.|
  Rat   262 LKPFLAIIAEVILLVAIILLCEVYTQKKKNDPDDGKEFEQIEQLKSDD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 20/97 (21%)
Ig 423..497 CDD:299845 18/94 (19%)
IG_like 500..583 CDD:214653 22/96 (23%)
Ig 512..575 CDD:143165 16/70 (23%)
EmbNP_446171.1 I-set 84..144 CDD:254352 14/78 (18%)
IG_like 172..255 CDD:214653 20/94 (21%)
Ig 177..252 CDD:143165 19/86 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..328 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.