DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and emb

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_002933091.2 Gene:emb / 100493043 XenbaseID:XB-GENE-6258633 Length:312 Species:Xenopus tropicalis


Alignment Length:259 Identity:54/259 - (20%)
Similarity:94/259 - (36%) Gaps:61/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 PGGVLIWKKNGTAVTDVPSLRGRFKLIAD----------ENKFIIDKTDTNDD------------ 475
            ||.....||....:::..|:|...||.:|          :::.:::..:|:|:            
 Frog    57 PGWSSETKKTKILISNTTSVRLECKLSSDPGECDVIWQHDSEKLLNVNNTSDNKCHTVYEFVLSD 121

  Fly   476 ----GKYSCEFDGVSKEIEVIARVVVRVPSNTAV------VEGEKMSVTCSVVGTKP-ELTWTFA 529
                |.|:|.|   ::..||.|...:.||:...|      ..|:.:.:.|......| |..|...
 Frog   122 PSKTGTYTCIF---NRSSEVKAEFHITVPAVKGVDKPLVTYNGDSIVMKCDSSKYNPIEWIWYKV 183

  Fly   530 N----VTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKC-----IGRNAANVYGGNTTTP 585
            |    |.|..:.|......:........|.:..::..|.|.|.|     :|.:...|        
 Frog   184 NESEKVQLNMSLDSTKYTVEHKRANETKLQVSALSEKDSGTYICKAIFKVGESEGQV-------- 240

  Fly   586 ASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELE---ESDTDPQEQKKKRRN 646
                 .:.|......|..|..|.|||.:|..:||:||.:..|.|.:   :::|:..|..|...:
 Frog   241 -----KLSVLSYMVPLKVFFIIAAEVAVLVTVILVYEMKTKKKEPQPDAQNETEQAENLKSEES 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 18/89 (20%)
Ig 423..497 CDD:299845 18/89 (20%)
IG_like 500..583 CDD:214653 18/98 (18%)
Ig 512..575 CDD:143165 14/72 (19%)
embXP_002933091.2 Ig 74..146 CDD:386229 14/74 (19%)
IG_like 161..244 CDD:214653 16/95 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.