| Sequence 1: | NP_723346.2 | Gene: | Bsg / 318841 | FlyBaseID: | FBgn0261822 | Length: | 648 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009291604.1 | Gene: | pxdn / 100332937 | -ID: | - | Length: | 1468 | Species: | Danio rerio |
| Alignment Length: | 231 | Identity: | 58/231 - (25%) |
|---|---|---|---|
| Similarity: | 92/231 - (39%) | Gaps: | 48/231 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 383 QGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMKFYDIRS--PLVLSCNVKDGTPGGVLIWKKNGTA 445
Fly 446 VTDVPSLRG--RFKLIADENKFIIDKTDTNDDGKYSCEFDGVSKEIEVIARVVVRV--------- 499
Fly 500 ---PSNTAVVEGEKMSVTCSVVG-TKPELTWTFANVTLTNATDRFILKPDDNGVPNAILTLDNVT 560
Fly 561 LDDRGEYKCIGRNAANVYGGN-----------TTTP 585 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bsg | NP_723346.2 | IG_like | 420..497 | CDD:214653 | 22/80 (28%) |
| Ig | 423..497 | CDD:299845 | 21/75 (28%) | ||
| IG_like | 500..583 | CDD:214653 | 24/94 (26%) | ||
| Ig | 512..575 | CDD:143165 | 17/63 (27%) | ||
| pxdn | XP_009291604.1 | LRRNT | 31..57 | CDD:214470 | |
| leucine-rich repeat | 59..106 | CDD:275378 | |||
| LRR_4 | 105..146 | CDD:289563 | |||
| LRR_8 | 106..165 | CDD:290566 | |||
| leucine-rich repeat | 107..130 | CDD:275378 | |||
| LRR_4 | 130..168 | CDD:289563 | |||
| leucine-rich repeat | 131..154 | CDD:275378 | |||
| leucine-rich repeat | 155..178 | CDD:275378 | |||
| leucine-rich repeat | 179..191 | CDD:275378 | |||
| LRRCT | 187..238 | CDD:214507 | 5/17 (29%) | ||
| Ig | 241..328 | CDD:299845 | 24/96 (25%) | ||
| I-set | 241..328 | CDD:254352 | 24/96 (25%) | ||
| Ig | 341..424 | CDD:299845 | 24/88 (27%) | ||
| IG_like | 343..424 | CDD:214653 | 24/86 (28%) | ||
| I-set | 428..514 | CDD:254352 | 3/7 (43%) | ||
| Ig | 441..514 | CDD:299845 | |||
| I-set | 520..606 | CDD:254352 | |||
| Ig | 537..605 | CDD:299845 | |||
| An_peroxidase | 736..1277 | CDD:281139 | |||
| peroxidasin_like | 857..1296 | CDD:188658 | |||
| VWC | 1410..1461 | CDD:214564 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||