DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and emb

DIOPT Version :9

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001108583.1 Gene:emb / 100141497 ZFINID:ZDB-GENE-070705-158 Length:300 Species:Danio rerio


Alignment Length:281 Identity:71/281 - (25%)
Similarity:105/281 - (37%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 GQGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKD---GTPGGVLIWKKNG 443
            ||| ||.::...:       |.|.|               :.|.||:.|   ..|.....|.|:|
Zfish    41 GQG-QVIIEELAI-------LTPQY---------------IELLCNLTDIPNNPPYMTGYWTKDG 82

  Fly   444 TAVTDVPSLRGRFKLIADENKFIIDKT---DTNDDGKYSCEFDGVSKEIEVIARVVVRVP----- 500
            ..:.:......|     :..::|:.||   ...|.|.|||.|    :|.:.....|::||     
Zfish    83 KEIENSEETINR-----NNAQYILKKTFSIQARDLGNYSCVF----RENDARVTFVLQVPVMKDK 138

  Fly   501 SNTAVVE--GEKMSVTCSVVGTKPELTWTFANVT---LTNAT-DRFILKPDDNGVPNAILTLDNV 559
            .:..||.  |:.:.:.|.:........|..||.|   |.|.| |....|...||....:..| |:
Zfish   139 RDKPVVSYIGDSVVLVCKLKHMPNTWNWYKANNTEKELINVTADPLKYKILLNGNETKLTAL-NL 202

  Fly   560 TLDDRGEYKCIGRNAANVYGGNTTTPASD-VTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK 623
            |....|:|.|         .......||: ...::|......|.||:.|.||||:|..:|.::||
Zfish   203 TEAQSGKYIC---------SAEFDIKASESQVELKVLSYTEPLKPFVAIVAEVLLLVTLICLWEK 258

  Fly   624 -RRNKSELEESDTDPQEQKKK 643
             .:.|.....:|....||..|
Zfish   259 CSKPKHSSSTADDVYSEQTSK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 IG_like 420..497 CDD:214653 19/82 (23%)
Ig 423..497 CDD:299845 19/79 (24%)
IG_like 500..583 CDD:214653 22/93 (24%)
Ig 512..575 CDD:143165 18/66 (27%)
embNP_001108583.1 IG_like 141..229 CDD:214653 23/97 (24%)
Ig 147..215 CDD:299845 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.