DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and TMEM38A

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_076979.1 Gene:TMEM38A / 79041 HGNCID:28462 Length:299 Species:Homo sapiens


Alignment Length:228 Identity:61/228 - (26%)
Similarity:105/228 - (46%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILGNLLLGSLPLEPLCNTADVMLSSLIWY 97
            :||....:.:.|..::....|...||..:|..:...||.:||||...::...|.:.::|:|.:||
Human    31 IVSILYLKYEPGAVELSRRHPIASWLCAMLHCFGSYILADLLLGEPLIDYFSNNSSILLASAVWY 95

  Fly    98 CIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHLAAQVYGNAPIPMLVVGTVMGSGAE 162
            .||:||.||.:.....|..:::..||..:.:|:.|..|:|.|...|.:....|:..|.|.|||..
Human    96 LIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFVMIATGWVKGSGVA 160

  Fly   163 VLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLE------VYKSPIIMGINRHQLMVYI 221
            ::.....||....:......|.:|..:|.:|:.::||.|:      |.|:.:|        .::.
Human   161 LMSNFEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLI--------FIFT 217

  Fly   222 LVMTTAFKFLSLCYRTDHIIWLLEQHIRYTLFG 254
            |.|.:...||:..:........||.:|...|||
Human   218 LFMVSCKVFLTATHSHSSPFDALEGYICPVLFG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 50/191 (26%)
TMEM38ANP_076979.1 TRIC 43..225 CDD:310067 50/189 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4641
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.