DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and tmem38b

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001016127.1 Gene:tmem38b / 548881 XenbaseID:XB-GENE-5849692 Length:284 Species:Xenopus tropicalis


Alignment Length:250 Identity:68/250 - (27%)
Similarity:113/250 - (45%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLPNHLIFRILHYSLISQQLRDELVVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILGNL 73
            ||.....|...||           :.|..|.|.:.|...|....|...|.:::|..:.|.||.::
 Frog    13 QLSMFPFFETAHY-----------LTSVMSAREQAGAVDVASRSPLASWFSSMLYCFGGGILSSI 66

  Fly    74 LLGSLPLEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHL 138
            ||...|:..|.||..::|:|.:||.::|.|:||.:.....|..|::...|..:::...|..||..
 Frog    67 LLAEPPVGILSNTTSIILASAVWYMVYYFPYDLFYNCFFFLPIRLILAGMKEVTRTWKILSGVAH 131

  Fly   139 AAQVYGNAPIPMLVVGTVMGSGAEVLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLEV 203
            |...|.:|.:.|:.:|...|:|..::.....|:....:.....:||:|...||.|..::||.|:.
 Frog   132 AHSHYKDAMLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSYPVKVTLIGAVLFTLQH 196

  Fly   204 YKSPIIMGINRHQLM-VY-----------ILVMTTAFKFLSLCYRTDHIIWLLEQ 246
            .:   .:.|:||.|| :|           :|..:||..||.|.....||::..:|
 Frog   197 GQ---YLPISRHNLMFIYTLFLILIKVTMMLTRSTASPFLPLETSLQHILFSRQQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 53/197 (27%)
tmem38bNP_001016127.1 TRIC 38..221 CDD:368332 50/185 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.