DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and Tmem38b

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_082329.1 Gene:Tmem38b / 52076 MGIID:1098718 Length:292 Species:Mus musculus


Alignment Length:243 Identity:71/243 - (29%)
Similarity:112/243 - (46%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILHY--SLISQQLRDELVVSAGSFRLKGGGNKVLEW-QPFVLWLANLLLNYAGDILGNLLLGS 77
            |.|.||  |:::.:.|...|.:|              | .|...||:.:|..:.|.||..:||..
Mouse    21 FDIAHYLVSVMALKQRPGAVAAA--------------WNNPLASWLSAMLHCFGGGILSCMLLAE 71

  Fly    78 LPLEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHLAAQV 142
            .||:.|.|..:::|:|.|||.:|:||.||.....|....:.||..|..:::...|..||..|...
Mouse    72 SPLKFLTNHTNILLASSIWYIVFFCPRDLVSQGYSYQPIQFLAAGMKEVTRTWKIVGGVSDANSY 136

  Fly   143 YGNAPIPMLVVGTVMGSGAEVLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLEVYKSP 207
            |.||.|.|:|||...|:|..|:.....||....:.....:||:|...|:.|..|::|..:..:. 
Mouse   137 YRNAWIVMIVVGWARGAGGAVVTACEQLLKGDWKPEGDEWLKMSFPCKITLLGSIMFTFQHTRH- 200

  Fly   208 IIMGINRHQLM-VYILVMTTAFKFLSLCYRTDHIIWLLEQHIRYTLFG 254
              :.|::|.|| :|.:.:.|....:.:...|...:...|..:...|||
Mouse   201 --LAISKHDLMFLYTIFLVTIKVTMMMTKDTAVTLTPFEDTLTRMLFG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 58/187 (31%)
Tmem38bNP_082329.1 TRIC 39..222 CDD:282982 60/199 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.