DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and CG33060

DIOPT Version :10

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster


Alignment Length:39 Identity:10/39 - (25%)
Similarity:21/39 - (53%) Gaps:7/39 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DRGVHLAAQVYGNAPIPMLVVGTVMGSGAEVLK-PVASL 170
            :|.:.|..:|     :|:|:.| ::|...|:.: |:..|
  Fly    69 ERRIFLEQEV-----VPILMEG-MLGLAREMPRDPIGYL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:461583 10/39 (26%)
CG33060NP_788513.2 DD_R_PKA_DPY30-like 71..111 CDD:445844 9/37 (24%)

Return to query results.
Submit another query.