powered by:
Protein Alignment CG33061 and CG33060
DIOPT Version :9
Sequence 1: | NP_001097620.1 |
Gene: | CG33061 / 318838 |
FlyBaseID: | FBgn0053061 |
Length: | 282 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788513.2 |
Gene: | CG33060 / 39807 |
FlyBaseID: | FBgn0053060 |
Length: | 121 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 10/39 - (25%) |
Similarity: | 21/39 - (53%) |
Gaps: | 7/39 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 DRGVHLAAQVYGNAPIPMLVVGTVMGSGAEVLK-PVASL 170
:|.:.|..:| :|:|:.| ::|...|:.: |:..|
Fly 69 ERRIFLEQEV-----VPILMEG-MLGLAREMPRDPIGYL 101
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33061 | NP_001097620.1 |
TRIC |
45..231 |
CDD:282982 |
10/39 (26%) |
CG33060 | NP_788513.2 |
Dpy-30 |
71..110 |
CDD:253069 |
9/37 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3944 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.