DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and tmem38a

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_988996.1 Gene:tmem38a / 394592 XenbaseID:XB-GENE-5802848 Length:295 Species:Xenopus tropicalis


Alignment Length:259 Identity:63/259 - (24%)
Similarity:117/259 - (45%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLPNHLIFRILHYSLISQQLRDELVVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILGNL 73
            :||...:|.:.:|           ::|....:.:.|...:.:..|...||..:|..:...||.::
 Frog    18 KLPVFPLFDVAYY-----------IISILYLKYEPGAVDLSKRSPVASWLCAMLYCFGSYILADV 71

  Fly    74 LLGSLPLEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHL 138
            |||..|:....|.|:::|:|.:||..|:||.::.:.:.|.|..:::...|..:.:|:.|..|:|.
 Frog    72 LLGESPIHYFSNNANILLASAVWYLTFFCPLNIFYKIVSFLPLKLVLVGMKEVVRVRKIAMGIHH 136

  Fly   139 AAQVYGNAPIPMLVVGTVMGSGAEVLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLEV 203
            |...|.:..:.|:::|.|.|||..::..:..||....:......|.:|..:|.:|:.::||.|: 
 Frog   137 AHHHYHHGWVIMVLIGWVKGSGVALMSNLEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQ- 200

  Fly   204 YKSPIIMGINRHQLMV---YILVMTTAFKFLSLCYRT---DH--IIWLLEQHIRYTLFGGLSRD 259
                     ..|.|.:   |::...|.|..:...|.|   .|  ...:.|..|...|||..:.|
 Frog   201 ---------QAHWLPISKAYLIFFFTLFMAICKIYMTATHSHGSPFAIFESGICCVLFGAANGD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 48/188 (26%)
tmem38aNP_988996.1 TRIC 43..225 CDD:368332 48/191 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.