DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and tmem38a

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_957194.1 Gene:tmem38a / 393874 ZFINID:ZDB-GENE-040426-1888 Length:295 Species:Danio rerio


Alignment Length:246 Identity:59/246 - (23%)
Similarity:115/246 - (46%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFRILHYSLISQQLRDELVVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILGNLLLGSLP 79
            :|.:.:|           :||....:.:.|..:|....|...||..:|..:...||.:::||..|
Zfish    24 VFDVAYY-----------IVSILYLKYEPGAVEVSRRSPVASWLCAMLYCFGSYILADIMLGVCP 77

  Fly    80 LEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHLAAQVYG 144
            ::...|.:.::|:|.:||.||:||.:|.:...:.:..:::..|:..:.:.:.|..|||.|...|.
Zfish    78 IDYFHNNSHILLASAVWYLIFFCPLNLFYKCVAFMPVKLVLVALKEVVRTRKIAAGVHHAHHAYH 142

  Fly   145 NAPIPMLVVGTVMGSGAEVLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLE------V 203
            :..:.|::.|.|.|||..::.....||....:......|.:|..:|.:|:.::||.|:      |
Zfish   143 HGWLIMVITGYVKGSGVALMSNFEQLLRGVWKPETNEVLNMSFPTKASLYGAILFTLQEAHVLPV 207

  Fly   204 YKSPIIMGINRHQLMVYILVMTTAFKFLSLCYRTDHIIWLLEQHIRYTLFG 254
            .||.:|        .::.|.|.::..|::..:.......|:|..:.:.|||
Zfish   208 SKSTLI--------CLFTLFMVSSKVFMTARHSHGSPFALIESWVCHVLFG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 48/191 (25%)
tmem38aNP_957194.1 TRIC 43..225 CDD:282982 48/189 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.