DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and tmem38b

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_956470.1 Gene:tmem38b / 393145 ZFINID:ZDB-GENE-040426-807 Length:289 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:125/250 - (50%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRQLPNHLIFRILHYSLISQQLRDELVVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILG 71
            |.:||....|.:.||           ::|..|.|.:.|...|.:..|...|.:::|..:.|.:|.
Zfish    16 LSKLPMFPYFDMAHY-----------IISVMSLREQPGALCVSQRSPLACWFSSMLYCFGGAVLS 69

  Fly    72 NLLLGSLPLEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGV 136
            .|:|...|:.||.||.:::|::|:||.:||||.|:.:::.|.|..|::.|||..:::...:..||
Zfish    70 ALMLADAPVAPLSNTTNLLLATLMWYLVFYCPLDVVYSLASLLPLRLVLTAMKEVTRTWKVLSGV 134

  Fly   137 HLAAQVYGNAPIPMLVVGTVMGSGAEVLKPVASLL--INRCQHNQMAYLKLSNTSKVALFISLLF 199
            ..|...|.:|...|:.||...|:|..::.....|:  :.:.:.|::  ||:|..:||.|..:::|
Zfish   135 SQAGSKYSDALFVMVAVGWAKGAGGGLISNFEQLVRGVWKPETNEL--LKMSYPTKVTLLGAVVF 197

  Fly   200 MLEVYKSPIIMGINRHQL-MVYILVMTTAFKFLSLCYRTDHIIWLLEQHIRYTLF 253
            .|:..:   .:.|..|.| .:|.|...|....:.|...:.|.:..||..:..|||
Zfish   198 SLQQCR---YLPIQTHHLTFIYTLFTVTNKTRMMLLGSSSHPLSSLESFLYKTLF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 54/188 (29%)
tmem38bNP_956470.1 TRIC 43..224 CDD:282982 54/185 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.