DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33061 and Tmem38b

DIOPT Version :9

Sequence 1:NP_001097620.1 Gene:CG33061 / 318838 FlyBaseID:FBgn0053061 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001014213.1 Gene:Tmem38b / 362521 RGDID:1305703 Length:291 Species:Rattus norvegicus


Alignment Length:243 Identity:69/243 - (28%)
Similarity:110/243 - (45%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILHY--SLISQQLRDELVVSAGSFRLKGGGNKVLEWQPFVLWLANLLLNYAGDILGNLLLGSL 78
            |.|.||  |:::.:.|...|.:|.|             .|...||:.:|..:.|.||..:||...
  Rat    21 FDIAHYLVSVMALKQRPGAVAAAWS-------------NPLSSWLSAMLHCFGGGILSCILLAEP 72

  Fly    79 PLEPLCNTADVMLSSLIWYCIFYCPFDLAHAVTSTLAFRILATAMSTISQVQLIDRGVHLAAQVY 143
            ||:.|.|..:::|:|.|||.:|:||.||.....|....::||..|..:::...|..||..|...|
  Rat    73 PLKFLTNHTNILLASSIWYIVFFCPRDLVSQGYSYQPIQLLAAGMKEVTRTWKIVGGVAHANGYY 137

  Fly   144 GNAPIPMLVVGTVMGSGAEVLKPVASLLINRCQHNQMAYLKLSNTSKVALFISLLFMLEVYKSPI 208
            .|..|.|:.||...|:|..::.....||....:.....:||:|...||.|..|::|..:..:.  
  Rat   138 RNGWIVMIAVGWARGAGGAIITACEQLLKGDWKPEGDEWLKMSFPCKVTLLGSIMFTFQHTRH-- 200

  Fly   209 IMGINRHQLMVYILVMTTAFKFLSLCYRTDHIIWL--LEQHIRYTLFG 254
             :.|::|.||....:.....| :::....|..:.|  .|..:...|||
  Rat   201 -LAISKHDLMFLYTIFLVTIK-VTMMMTKDAAVTLTPFEDTLTRMLFG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33061NP_001097620.1 TRIC 45..231 CDD:282982 54/185 (29%)
Tmem38bNP_001014213.1 TRIC 39..222 CDD:282982 57/199 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..291
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1319985at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.