DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and TRPT1

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001153861.1 Gene:TRPT1 / 83707 HGNCID:20316 Length:255 Species:Homo sapiens


Alignment Length:214 Identity:81/214 - (37%)
Similarity:124/214 - (57%) Gaps:17/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQINTQLSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTL 69
            |..:.||||.||:.|||||...|:.:.|||||.:..|.:.|::..|:.|.::.:...:.|||:.|
Human    25 QDRDVQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFAL 89

  Fly    70 R-WNPELGVHEIRANQGHSLAVLEGEAGGLENI------THVSQVPLAVHGTYYRHWGAIRSQGL 127
            : .:|..|: .|||||||||.|      |:..:      |..:..|:.||||:::||.:|..:||
Human    90 QLGDPSTGL-LIRANQGHSLQV------GVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGL 147

  Fly   128 SRMNRNHVHFACS-DETNSTLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPG-IEGFIH 190
            |...|.|:|.|.. ......:||.||.|:|.::::....||||||.:||:|.|:|.|| .:||:.
Human   148 SCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLL 212

  Fly   191 SSYFQRVVD-KKTGQPLQI 208
            ..||:..:. :.|.:||.:
Human   213 PKYFKEALQLRPTRKPLSL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 70/179 (39%)
TRPT1NP_001153861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 1/3 (33%)
PTS_2-RNA 31..204 CDD:280125 70/179 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..255 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141424
Domainoid 1 1.000 129 1.000 Domainoid score I5292
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12878
Inparanoid 1 1.050 138 1.000 Inparanoid score I4540
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54974
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - oto88613
orthoMCL 1 0.900 - - OOG6_102028
Panther 1 1.100 - - LDO PTHR12684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1542
SonicParanoid 1 1.000 - - X4245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.