DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and AT5G23600

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_197750.1 Gene:AT5G23600 / 832426 AraportID:AT5G23600 Length:212 Species:Arabidopsis thaliana


Alignment Length:195 Identity:75/195 - (38%)
Similarity:111/195 - (56%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLC-------FTLEKLKEIAAADAKQRYT 68
            |.:.|:.:|||.|....:.:|.||||.|.||.......|       .|:::::|....|.|:|::
plant    10 LGRILTRILRHMATELRLNMRGDGFVKVEDLLNLNLKTCANIQLNSHTIDEIREAVTRDNKKRFS 74

  Fly    69 LRWNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGLSRMNRN 133
            |  ..|.|...||||||||:..:|.|. .|:.|....:.|:.|||||.::..:|.:.||.||||.
plant    75 L--IDEDGELLIRANQGHSITTVESEK-LLKPILSPEEAPVCVHGTYRKNLESILASGLKRMNRM 136

  Fly   134 HVHFACSDETN-STLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPGIEGFIHSSYFQRV 197
            ||||:|...|: ..:||.|.:..::|:|:::|.|.|||..|.|.|.|:|..||.|.:...|||::
plant   137 HVHFSCGLPTDGEVISGVRRNVNVIIFLHIKKALEDGIAFYISDNKVILTQGIVGVLPVDYFQKI 201

  Fly   198  197
            plant   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 69/179 (39%)
AT5G23600NP_197750.1 PTS_2-RNA 5..188 CDD:396455 69/180 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1994
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12878
Inparanoid 1 1.050 128 1.000 Inparanoid score I1904
OMA 1 1.010 - - QHG54974
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - otm3084
orthoMCL 1 0.900 - - OOG6_102028
Panther 1 1.100 - - O PTHR12684
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4245
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.