DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and emb1067

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_182058.2 Gene:emb1067 / 819141 AraportID:AT2G45330 Length:289 Species:Arabidopsis thaliana


Alignment Length:201 Identity:76/201 - (37%)
Similarity:113/201 - (56%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSKKLSWLLRHGAKTEGITIRADGFVSVPD-------------LQKHPRYLCFTLEKLKEIAAAD 62
            |.:.|:.:|||.|....:.:|.||||.|.|             |:.|      |:::::|....|
plant    87 LGRLLTRILRHMATELRLNMRGDGFVKVEDLLNLNLKTSANIQLKSH------TIDEIREAVRRD 145

  Fly    63 AKQRYTLRWNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGL 127
            .|||::|  ..|.|...||||||||:..:|.|. .|:.|....:.|:.|||||.::..:|.:.||
plant   146 NKQRFSL--IDENGELLIRANQGHSITTVESEK-LLKPILSPEEAPVCVHGTYRKNLESILASGL 207

  Fly   128 SRMNRNHVHFACSDETN-STLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPGIEGFIHS 191
            .||||.||||:|...|: ..:||.|.:..::|:|:::|.|.|||..|.|.|.|:|..||:|.:..
plant   208 KRMNRMHVHFSCGLPTDGEVISGMRRNVNVIIFLDIKKALEDGIAFYISDNKVILTEGIDGVLPV 272

  Fly   192 SYFQRV 197
            .|||::
plant   273 DYFQKI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 70/185 (38%)
emb1067NP_182058.2 PTS_2-RNA 86..265 CDD:396455 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1994
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12878
Inparanoid 1 1.050 128 1.000 Inparanoid score I1904
OMA 1 1.010 - - QHG54974
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - otm3084
orthoMCL 1 0.900 - - OOG6_102028
Panther 1 1.100 - - LDO PTHR12684
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4245
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.