DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and Trpt1

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001099801.1 Gene:Trpt1 / 293704 RGDID:1310831 Length:248 Species:Rattus norvegicus


Alignment Length:208 Identity:85/208 - (40%)
Similarity:123/208 - (59%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQINTQLSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTL 69
            |..|.||||.||:.|||||...|:.:||||||.:..|.:.|::..|::|.::.:...:.|||:||
  Rat    20 QDRNVQLSKALSYALRHGALKLGLPMRADGFVPLQALLQLPQFHSFSIEDVQLVVDTNEKQRFTL 84

  Fly    70 R-WNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGLSRMNRN 133
            : ..|..| ..|||||||||.|.|.|...||  |..:.....||||:::||.:|...||||..|.
  Rat    85 QPGEPSTG-PLIRANQGHSLQVPELELMPLE--TPQALPSTLVHGTFWKHWPSILLNGLSRQGRT 146

  Fly   134 HVHFACSDETNS-TLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPG-IEGFIHSSYFQR 196
            |:|.|.....:| .:||.|.:|::.:::|....|.||||.:.|.|.|:|.|| .:||:...||:.
  Rat   147 HIHLASGLPGDSGVISGIRPNCEVAVFINGALALTDGIPFFCSVNGVILTPGNADGFLLPKYFKE 211

  Fly   197 VVD-KKTGQPLQI 208
            .:. :.|.:||.:
  Rat   212 ALQLRPTRKPLSL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 73/173 (42%)
Trpt1NP_001099801.1 PTS_2-RNA 26..197 CDD:280125 73/173 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335103
Domainoid 1 1.000 132 1.000 Domainoid score I4984
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12878
Inparanoid 1 1.050 141 1.000 Inparanoid score I4404
OMA 1 1.010 - - QHG54974
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - oto95745
orthoMCL 1 0.900 - - OOG6_102028
Panther 1 1.100 - - LDO PTHR12684
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.