DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33057 and SPAC2C4.12c

DIOPT Version :9

Sequence 1:NP_001286980.1 Gene:CG33057 / 318833 FlyBaseID:FBgn0053057 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_594515.2 Gene:SPAC2C4.12c / 2541572 PomBaseID:SPAC2C4.12c Length:365 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:77/190 - (40%)
Similarity:106/190 - (55%) Gaps:12/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTLRWNPEL- 75
            ||.||.:|||.||..|:.||.||::.|..:.|.|::....:|.|..|...:.|:|:|:.   |: 
pombe    42 SKALSKVLRHTAKANGLQIREDGYIEVDSILKLPQFRGMGMELLLSIVKGNDKKRFTME---EVE 103

  Fly    76 GVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGLSRMNRNHVHFAC- 139
            ||..||||||||:..::.....::|   .|.:|..||||....|..|..||||||.|||:|.|. 
pombe   104 GVLYIRANQGHSIKAVQVPMARIDN---ASSIPKVVHGTKKELWPVISKQGLSRMKRNHIHCATG 165

  Fly   140 --SDETNSTLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPGIEGFIHSSYFQRV 197
              .|.  ..:||.|..|.:.||::..|.:.||:..|||.|.|:|..|:.|.:.|.||.||
pombe   166 LYGDP--GVISGIRKSCTLYIYIDSAKAMQDGVEFYRSENGVILTEGVNGLLSSKYFSRV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33057NP_001286980.1 PTS_2-RNA 11..183 CDD:280125 70/174 (40%)
SPAC2C4.12cNP_594515.2 PTS_2-RNA 42..209 CDD:280125 70/174 (40%)
Yae1_N 280..318 CDD:286849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1438
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12878
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005232
OrthoInspector 1 1.000 - - oto100565
orthoMCL 1 0.900 - - OOG6_102028
Panther 1 1.100 - - LDO PTHR12684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1542
SonicParanoid 1 1.000 - - X4245
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.